LL-37 ZPHC – 25mg KIT (5×5 mg)
Original price was: $320.00.$290.00Current price is: $290.00.
Description
Buy LL-37 ZPHC – 25mg KIT (5×5 mg)
Product Overview
The LL-37 ZPHC 25mg KIT provides research-grade lyophilized human cathelicidin antimicrobial peptide (LL-37) in a convenient 5 x 5 mg vial format. LL-37 is the only known cathelicidin-type host defense peptide found in humans and represents a critical component of the innate immune system . This amphipathic, alpha-helical peptide consisting of 37 amino acids with a molecular weight of 4493.3 Daltons exhibits broad-spectrum antimicrobial activity and immunomodulatory properties extensively documented in peer-reviewed literature .
Each kit contains five individual 5 mg vials of lyophilized LL-37, providing a total of 25 mg of high-purity peptide suitable for controlled reconstitution and precise dosing in research applications. The peptide sequence (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES) corresponds to the active C-terminal domain of the human cathelicidin precursor protein hCAP18 .
Key Features
High Purity Grade: Manufactured under ISO/GMP guidelines with HPLC purity of ≥99%, meeting rigorous quality control standards for research applications .
Lyophilized Format: Each 5 mg vial contains freeze-dried peptide in a nitrogen-filled borosilicate glass vial, ensuring stability and facilitating precise reconstitution for controlled dosing.
Sterile Matched Diluent: Includes sterile diluent optimized for peptide reconstitution, maintaining integrity and bioactivity.
Verification System: Holographic scratch-code verification system ensures product authenticity and quality assurance.
CRM-Grade Synthesis: Manufactured using controlled raw material (CRM) grade synthesis protocols to ensure batch-to-batch consistency.
Biological Activity and Research Applications
LL-37 demonstrates multiple mechanisms of action that make it valuable for immunological and microbiological research:
Antimicrobial Activity: Exhibits potent activity against Gram-positive bacteria (including Staphylococcus aureus and Streptococcus species), Gram-negative bacteria (including Escherichia coli, Pseudomonas aeruginosa, and Klebsiella pneumoniae), and certain viruses . Research demonstrates minimum inhibitory concentrations (MICs) ranging from 1.27 µg/mL for susceptible strains to approximately 35 µg/mL for more resistant organisms .
Antibiofilm Properties: LL-37 effectively disrupts bacterial biofilms and prevents initial bacterial adhesion, with antibiofilm activity observed at concentrations significantly lower than those required for direct bactericidal effects .
Immunomodulatory Functions: The peptide modulates innate immunity through binding and inactivation of bacterial endotoxins (LPS and LTA), promotes chemotaxis of immune cells (neutrophils, monocytes, T cells), and influences cytokine secretion profiles .
Host Cell Interactions: LL-37 has been shown to affect cell migration, modulate inflammatory responses, and influence wound healing processes in various cell types .
Reconstitution and Handling
The lyophilized LL-37 peptide is freely soluble in sterile water or aqueous solutions. For optimal results:
-
Allow the sealed vial to reach room temperature before opening
-
Reconstitute with the provided sterile matched diluent or sterile water for injection
-
Gently swirl or invert the vial to ensure complete dissolution without vigorous agitation
-
Prepare aliquots to minimize freeze-thaw cycles, as repeated freezing and thawing may compromise peptide activity
Storage and Stability
-
Lyophilized peptide: Store at -20°C or below, protected from moisture and light
-
Reconstituted peptide: Aliquot and store at -20°C or below; avoid repeated freeze-thaw cycles
-
Stability: Product maintains stability for at least one year when stored under recommended conditions
Quality Assurance
Each vial undergoes rigorous quality control testing including:
-
HPLC analysis confirming ≥99% purity
-
Mass spectrometry verification of molecular weight
-
Sterility testing
-
Endotoxin testing
TOP 10 FREQUENTLY ASKED QUESTIONS
1. What is LL-37 and what is its biological role?
LL-37 is the only human cathelicidin antimicrobial peptide, consisting of 37 amino acids. It functions as a host defense peptide with broad-spectrum antimicrobial activity against bacteria, fungi, and viruses, while also modulating immune responses and promoting wound healing .
2. What is the purity level of this LL-37 product?
This product is manufactured with HPLC purity of ≥99%, verified through comprehensive quality control testing under ISO/GMP guidelines.
3. How should I store the lyophilized peptide?
Store the lyophilized peptide at -20°C or below in a dry, light-protected environment. Under these conditions, the product remains stable for at least one year .
4. How should I reconstitute the peptide?
Reconstitute using the provided sterile matched diluent or sterile water for injection. Allow the vial to reach room temperature before opening, add the diluent, and gently swirl to dissolve without vigorous agitation .
5. Can reconstituted peptide be stored?
Yes, but it should be aliquoted immediately after reconstitution and stored at -20°C or below. Repeated freeze-thaw cycles will cause loss of activity. For short-term use (2-7 days), storage at 4°C is acceptable .
6. What is the molecular weight of LL-37?
The molecular weight of LL-37 is approximately 4493.3 Daltons, with a molecular formula of C205H340N60O53 .
7. What organisms is LL-37 active against?
LL-37 demonstrates activity against Gram-positive bacteria (S. aureus, S. epidermidis), Gram-negative bacteria (E. coli, P. aeruginosa, K. pneumoniae), fungi (Candida albicans), and certain viruses including influenza and HIV .
8. What is the research significance of LL-37?
LL-37 is crucial for studying innate immune mechanisms, antimicrobial resistance, biofilm formation, wound healing, and immunomodulation. Its dual role in both antimicrobial defense and immune regulation makes it valuable for diverse research applications .
9. Is this product intended for human or therapeutic use?
This product is for research purposes only and is not intended for human therapeutic use, diagnostic purposes, or clinical applications.
10. How is product authenticity verified?
Each vial features a holographic scratch-code verification system allowing for authenticity confirmation prior to use.
References and Further Reading
-
Durr UH, et al. LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochim Biophys Acta. 2006;1758(9):1408-25.
-
Hou M, et al. Antimicrobial peptide LL-37 and IDR-1 ameliorate MRSA pneumonia in vivo. Cell Physiol Biochem. 2013;32(3):614-23.
-
Liu Q, Xu P, Zhang C. LL-37: Biological Mechanisms and Emerging Therapeutic Applications in Intestinal Disease. Immunity, Inflammation and Disease. 2026.
-
The Potential of Human Recombinant Cathelicidin LL-37 in the Treatment of Infections. International Journal of Peptide Research and Therapeutics. 2026;32:1.
-
Human antimicrobial/host defense peptide LL-37 may prevent the spread of a local infection through multiple mechanisms: an update. Inflammation Research. 2025;74:36.
-
LL-37, the master antimicrobial peptide, its multifaceted role from combating infections to cancer immunity. Journal of Global Antimicrobial Resistance. 2024.
This LL-37 ZPHC 25mg KIT is available for research purposes. For detailed product information, ordering, and technical support, please visit:
https://anabolicsteroidsonline.shop/
Research-grade peptides require proper handling and storage. Ensure your laboratory is equipped for peptide research before ordering. All products are for in-vitro research use only and are not for human consumption or therapeutic application.







Reviews
There are no reviews yet.